Daemon software delivers value through our Business and IT consulting Services that help clients improve performance & reduce costs by harnessing the power of the digital economy.

4.20 Rating by CuteStat

daemon.co.in is 1 decade 5 years old. It is a domain having co.in extension. It has a global traffic rank of #3860244 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, daemon.co.in is SAFE to browse.

PageSpeed Score
68
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 218
Daily Pageviews: 436

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 168
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 12,200,000
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 3,860,244
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

166.62.12.1

Hosted Country:

Singapore SG

Location Latitude:

1.2929

Location Longitude:

103.8547

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 14 H2 Headings: 3
H3 Headings: 3 H4 Headings: 9
H5 Headings: 1 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 21
Google Adsense: Not Applicable Google Analytics: UA-77855144-1

Websites Hosted on Same IP (i.e. 166.62.12.1)

Obeikan Education: Under Construction

- obeikaneducation.com
3,430,775 $ 480.00

Rajasthan Textiles | Traditional Fabric | Rajasthan Textiles Industrie

- rajasthantextiles.com

Rajasthan has a wide variety of textile traditions, most famous being the tie and dye or Bandhani and block printing method. Rajasthani textiles come in a fascinating color range of dyed and block-printed fabric which are further embroidered. Jaipur's quilts are a hot favorite with most tourists. Tie-and-dye textiles,

6,713,829 $ 240.00

Taipei Aunty

- taipeiaunty.com

聯絡方式

Not Applicable $ 8.95

Coming Soon - Future home of something quite cool

- odishafetalmed.org
Not Applicable $ 8.95

Coming Soon - Future home of something quite cool

- etiplatformbeta.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sat, 14 Dec 2019 18:25:26 GMT
Server: Apache
Link: <http://daemon.co.in/wp-json/>; rel="https://api.w.org/", <http://daemon.co.in/>; rel=shortlink
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Cache-Control: max-age=2592000
Expires: Mon, 13 Jan 2020 18:25:26 GMT
Content-Length: 11629
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: Rediff.com India Limited
Registration Date: Dec 28, 2008, 1:27 PM 1 decade 5 years 3 months ago
Expiration Date: Dec 28, 2019, 1:27 PM 4 years 3 months 4 weeks ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
ns33.domaincontrol.com 97.74.106.17 United States of America United States of America
ns34.domaincontrol.com 173.201.74.17 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
daemon.co.in A 3597 IP: 166.62.12.1
daemon.co.in NS 3600 Target: ns33.domaincontrol.com
daemon.co.in NS 3600 Target: ns34.domaincontrol.com
daemon.co.in SOA 600 MNAME: ns33.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019112003
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 600
daemon.co.in MX 1800 Priority: 10
Target: in.hes.trendmicro.com
daemon.co.in MX 1800 Target: in.hes.trendmicro.com
daemon.co.in TXT 1800 TXT: google-site-verification=ZBgmyPD8Ow5gtb3
sKQMWKFQ0HB2sPq9K4MhPxX3kPa0
daemon.co.in TXT 1800 TXT: v=spf1 include:mem.mithi.com ~all 3600s
(1h)
daemon.co.in TXT 1800 TXT: google-site-verification=O4a7Qj9EpvfVneM
Tpq4y3YJH5KeJRjhFhP81GaD27Ko

Similarly Ranked Websites

ATS - Leading Electrical Solutions Provider in Cambodia | Home

- ats.com.kh

ATS is a specialist of energy and electrical distribution and automation systems. We supply, design and manufacture solutions meeting specific clients and projects thanks to our manufacturing facility and our multi-technologies / multi-brands approach.

3,860,249 $ 240.00

ClickFunnels™ - Marketing Funnels Made Easy

- physique-zero.com

ClickFunnels Gives You EVERYTHING You Need To Market, Sell, and Deliver Your Products and Services Online! Without having to hire or rely on a tech team!

3,860,251 $ 240.00

ELEKTRİKLİ BİSİKLETLER BEYİNLER AKÜLER TANITIMLAR ELEKTRİKLİ BİSİKLET

- elektriklibisiklet.org

elektrikli bisiklet şarj,elektrikli bisiklet,elektrikli bisiklet beyin,elektrikli bisiklet modifiye,led far,power led far,elektrikli bisiklet aküsü,elektrikli scoter,elektrikli bisiklet gaz kolu,elektrikli bisiklet aküsü,12 volt 20 amper akü,jel akü,

3,860,256 $ 240.00

404 Not Found

- watchintenselyswiftthefile.vip
3,860,262 $ 240.00

SU VAKFI BÜLTENLERİ

- bulten.suvakfi.org.tr
3,860,263 $ 240.00

Full WHOIS Lookup

Domain Name: daemon.co.in
Registry Domain ID: D3230458-IN
Registrar WHOIS Server:
Registrar URL: http://www.rediff.co.in
Updated Date: 2014-12-13T04:39:10Z
Creation Date: 2008-12-28T07:42:34Z
Registry Expiry Date: 2019-12-28T07:42:34Z
Registrar: Rediff.com India Limited
Registrar IANA ID: 800140
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name:
Registrant Organization: daemon.co.in
Registrant Street:
Registrant Street:
Registrant Street:
Registrant City:
Registrant State/Province: Singapore
Registrant Postal Code:
Registrant Country: SG
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Please contact the Registrar listed above
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin Street:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Please contact the Registrar listed above
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech Street:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Please contact the Registrar listed above
Name Server: ns33.domaincontrol.com
Name Server: ns34.domaincontrol.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2019-12-14T18:25:47Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only ,and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator or a Registrar, or Neustar except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.